PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021871P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 297aa    MW: 33482.7 Da    PI: 6.2273
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021871P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd+++++G g+W++ ++  g++R++k+c++rw +yl
   MELO3C021871P1 14 KGPWTPEEDRKLVDYIEKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.41.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E+++++++++ lG++ W+ Ia++++ gRt++++k++w+++l
   MELO3C021871P1  67 RGNFSDQEEQIIINLHASLGNK-WSIIASHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.162961IPR017930Myb domain
SuperFamilySSF466895.62E-3211108IPR009057Homeodomain-like
SMARTSM007174.1E-161363IPR001005SANT/Myb domain
PfamPF002496.1E-181461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-251568IPR009057Homeodomain-like
CDDcd001677.89E-131661No hitNo description
PROSITE profilePS5129426.762116IPR017930Myb domain
SMARTSM007172.0E-1666114IPR001005SANT/Myb domain
PfamPF002493.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.12E-1169112No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2769116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MSGSPTAEEN GIKKGPWTPE EDRKLVDYIE KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF SDQEEQIIIN LHASLGNKWS IIASHLPGRT DNEIKNFWNT HLKKKLLQMG  120
IDPVTHMPIT DHHHLTTLSN LHHLLSLNDA TQLAKAQLLQ NLLQLLASQS SLSISNNNVF  180
NTQQILDLNY NLPIGSFLQN IPINIEPPQE PLSCDDYTVG TDGVLGFQND TDRIKTFYDM  240
NQRLNSLPNL IPASPECSKI PTTIENNWEE DLMDVEASDS SWKHVIDQTP PSWTVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819140.0LN681914.1 Cucumis melo genomic scaffold, anchoredscaffold00050.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459176.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLA0A0A0LND60.0A0A0A0LND6_CUCSA; Uncharacterized protein
STRINGVIT_16s0039g01710.t011e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.13e-77myb domain protein 93